PNC-27 Peptide

PNC-27 Peptide (p53-HDM-2 Antagonist Peptide)

Welcome to buypeptidesonlineusa.com, your premier domestic source for high-purity research peptides. Our PNC-27 peptide is a synthetic 32-amino acid chimeric peptide, ingeniously designed by combining the HDM-2 binding domain of the p53 tumor suppressor protein with a cell-penetrating peptide (CPP) leader sequence. It is meticulously manufactured for advanced investigations into oncology, cancer cell biology, membrane biophysics, and targeted necrosis. As a peptide with a unique, cancer cell-specific mechanism of action that induces rapid physical cell lysis, PNC-27 is an essential tool for researchers exploring innovative, non-apoptotic pathways for cancer therapeutics. We ensure your critical research is supported by uncompromising quality, transparency, and rapid fulfillment.

🚚 FREE SHIPPING ON ORDERS OVER $300 | 🔐 SECURE CHECKOUT & DISCREET PACKAGING

⚠️ Important Research Compliance Notice

This product is intended strictly for laboratory research use only and is not for human consumption or veterinary use. This product is not a medicine, drug, or medical device. It has not been evaluated by the FDA. This peptide is sold for investigational purposes by qualified researchers and professionals only.

🔬 What is PNC-27 Peptide?

PNC-27 is a synthetic, 32-residue chimeric peptide composed of two distinct functional domains . The first domain is a sequence (residues 12-26) derived from the p53 tumor suppressor protein, which is responsible for binding to the HDM-2 protein (human homolog of MDM2). The second domain is a membrane-penetrating peptide sequence (a penetratin leader) derived from the Antennapedia protein, which facilitates interaction with and insertion into cell membranes .

This unique design allows PNC-27 to exploit a fundamental difference between cancer cells and normal, untransformed cells. Its key mechanism of action is a selective, multi-step process termed peptide-induced poptosis :

• Selective Targeting via Membrane-Bound HDM-2: Many human cancer cells overexpress the HDM-2 protein and, crucially, a significant amount of this HDM-2 is embedded in the outer plasma membrane. Normal cells do not express HDM-2 in their membranes. The p53-derived portion of PNC-27 binds specifically to this membrane-bound HDM-2 at its p53 binding site (residues 1-109) .
• Membrane Insertion and Pore Formation: Once bound to its target, the penetratin domain helps anchor PNC-27 into the lipid bilayer. PNC-27 then forms a 1:1 complex with HDM-2. These complexes dimerize in a highly temperature-dependent step, forming transmembrane pores or channels .
• Rapid Cancer Cell Necrosis (Lysis): The formation of these pores disrupts the cell's osmotic balance, allowing water and ions to rush in uncontrollably. This causes the cancer cell to swell and burst (lyse), resulting in rapid necrotic cell death. This process is fundamentally different from the slower, programmed cell death (apoptosis) induced by many chemotherapies .
• Mitochondrial Disruption: Recent 2024 research published in PubMed has revealed a secondary mechanism: PNC-27 can also enter cancer cells and bind to mitochondrial membranes, causing mitochondrial disruption and further contributing to cell death .

A 2025 study from Cornell University confirmed this mechanism in cervical cancer cells (HTB-35/SiHa), finding PNC-27 cytotoxic even at low doses (IC50=12.4 μM) to cancer cells while having no effect on normal cervical cells (PCS-480) .

✅ Why Choose Buy Peptides Online USA for Your Research?

When you need to buy PNC-27 peptide online, quality and consistency are non-negotiable. Here is why discerning researchers choose us:

• Verified High Purity: We provide access to independent third-party Certificate of Analysis (COA) documents, confirming purity via High-Performance Liquid Chromatography (HPLC) at ≥98% and identity via Mass Spectrometry (MS) . Competitor analysis shows available purities ranging from >96% to >99% .
• Authentic Chimeric Structure: Our peptide has the full, correct 32-amino acid sequence (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) with the molecular formula C188H293N53O44S and a molecular weight of ~4031.7 g/mol, matching the compound validated in pre-clinical studies .
• Optimal Storage & Handling: Our PNC-27 is shipped in lyophilized (freeze-dried) powder form. For long-term stability, store desiccated at -20°C or below . In lyophilized form, it is stable for up to 3 years .
• Domestic Shipping: As a USA-based supplier, we offer fast, reliable shipping. Orders typically arrive within 2-5 business days in discreet packaging.
• Research-Focused: We make no medical claims. Our service is built on integrity, providing accurately labeled products for legitimate scientific inquiry.

🔎 Product Specifications & Technical Data

To ensure your research parameters are met with precision, here are the verified technical specifications for our PNC-27 peptide. Purity and correct structure are critical determinants of research accuracy, and our product meets the high standards expected by the scientific community.

🧪 Key Research Applications & Focus Areas

PNC-27's unique cancer cell-specific lytic mechanism makes it a powerful and precise tool across a spectrum of cutting-edge oncology research, as validated by numerous recent studies .

• 🩺 Targeted Cancer Cell Lysis (Necrosis) Research: The foundational application of PNC-27. It is used to study a novel form of cell death distinct from apoptosis. Researchers employ PNC-27 to model and investigate the rapid, physical destruction of cancer cells via transmembrane pore formation. It has been shown to be cytotoxic to a wide variety of cancer cells, including pancreatic, breast, cervical, leukemia, and melanoma lines, while leaving normal cells unharmed .

• 🧬 HDM-2 Biology & p53 Pathway Research: PNC-27 is an invaluable tool for probing the interaction between p53 and HDM-2, specifically at the cell membrane. Recent 2024 research using monoclonal antibodies confirmed PNC-27 binds to the p53 binding site of HDM-2 (residues 1-109) . It allows researchers to study the consequences of this interaction in a non-nuclear context and explore membrane-bound HDM-2 as a unique cancer biomarker.

• 🔄 Chemotherapy-Resistant Cancer Research: PNC-27 has demonstrated cytotoxicity against chemotherapy-resistant cancers and primary tumors, making it a key tool for studying treatment-refractory cancers . Its mechanism of physical lysis may bypass the resistance pathways (e.g., efflux pumps, apoptotic defects) that render traditional drugs ineffective.

• 🧪 Mitochondrial Disruption & Cancer Metabolism: A 2024 study revealed that PNC-27 also enters cancer cells and binds to mitochondrial membranes, causing mitochondrial disruption . This opens new avenues for research into its dual mechanism and its effects on cancer cell metabolism and energy production.

• ⚗️ In Vivo Efficacy Models: PNC-27 has been successfully tested in animal models. Studies have shown it can effectively treat highly metastatic pancreatic tumors and stem-cell-enriched human acute myelogenous leukemias in nude mice with no evidence of off-target effects .

📝 Handling, Storage, and Preparation for Research

Proper handling is critical to maintaining PNC-27's integrity and ensuring experimental validity .

• Receiving & Storage: Upon receipt, store the lyophilized vial in a freezer at -20°C (-4°F) or below. Protect from light and moisture. Lyophilized peptide is stable for up to 3 years under these conditions .
• Reconstitution: To prepare stock solutions, allow the vial to reach room temperature in a desiccator. It is recommended to reconstitute in sterile 18MΩ-cm H₂O at a concentration of at least 100 µg/ml . Gently swirl or invert to dissolve; do not vortex to prevent denaturation.
• Aliquoting & Storage Post-Reconstitution: It is highly recommended to prepare single-use aliquots immediately after reconstitution to avoid activity loss from repeated freeze-thaw cycles.
  • For short-term use (2-7 days), store aliquots at 4°C .
  • For long-term storage, store aliquots at -80°C for up to 6 months, or at -20°C for up to 1 month. Adding a carrier protein (0.1% HSA or BSA) is recommended for long-term stability .
• Dosage Considerations (for reference):
  • In vitro: Studies have shown cytotoxicity in cervical cancer cells with an IC₅₀ of 12.4 μM . Other studies have used concentrations like 50 μg/mL to induce cell death within hours .
  • In vivo (Rodent): In leukemia mouse models, intraperitoneal injections of 40 mg/kg once daily were used . Researchers must determine optimal dosing based on literature and IACUC guidelines.
• Safety & Handling: Always use personal protective equipment (PPE) such as gloves and safety goggles when handling. Work in a laminar flow hood or well-ventilated area. Dispose of all waste in appropriate biohazard containers.

❓ Frequently Asked Questions (FAQ)

Q1: What makes PNC-27 selectively toxic to cancer cells?

A: Its selectivity is based on the unique presence of membrane-bound HDM-2 on the surface of many cancer cells, which is absent in normal cells. PNC-27 binds specifically to this membrane-bound HDM-2, allowing it to insert into the cancer cell membrane and form lethal pores .

Q2: What is the difference between the mechanism of PNC-27 and traditional chemotherapy?

A: Traditional chemotherapies often work by damaging DNA or interfering with cell division, which can trigger apoptosis (programmed cell death). PNC-27 induces a rapid, physical form of cell death called necrosis by directly punching holes (pores) in the cancer cell membrane, causing it to burst .

Q3: How do I verify the quality of your PNC-27?

A: We are committed to transparency. Our product listings provide access to a third-party Certificate of Analysis (COA) . This document validates the compound's identity via Mass Spectrometry (MS) and its purity via High-Performance Liquid Chromatography (HPLC), which is ≥98% .

Q4: What are the primary research areas for PNC-27?

A: It is primarily used in targeted cancer research (for pancreatic, breast, cervical, leukemia cancers), studies on chemotherapy-resistant tumors, HDM-2/p53 interaction studies, and investigations into novel cell death mechanisms (poptosis/necrosis) .

Q5: How should I store PNC-27 after reconstitution?

A: Immediately prepare single-use aliquots. For long-term storage, store aliquots at -80°C for up to 6 months, or -20°C for up to 1 month. Adding a carrier protein like 0.1% BSA is recommended. Avoid repeated freeze-thaw cycles .

📦 Our Services & Guarantees

• 24/7 Customer Support: Our team is available to answer your pre- and post-sales questions.
• Authenticity Guarantee: We guarantee that you receive the exact product described, with full documentation and lot matching.
• Product Replacement: In the unlikely event of damage during shipping, we have a clear process for claims and replacement.
• Technical Consultation: Contact us for assistance with solubility or handling protocols.

🚀 How to Buy PNC-27 Peptide Online

Purchasing from buypeptidesonlineusa.com is simple and secure.

1. Browse & Select: Choose the quantity you need (e.g., 1mg, 5mg, 10mg vial) .
2. Add to Cart: Proceed to our secure checkout.
3. Payment: We accept major credit cards and cryptocurrency (Bitcoin, Ethereum, USDT) for privacy and convenience.
4. Shipping: Orders are processed within 24 hours on business days and shipped in discreet, temperature-controlled packaging. Domestic orders typically arrive in 2-5 days.

Ready to advance your targeted cancer research? Add high-purity PNC-27 peptide to your cart today.