FOX04-DRI Peptide (Proxofim)

$220.00

FOXO4-DRI (Proxofim) is a synthetic D-retro-inverso peptide designed to disrupt the FOXO4-p53 interaction, selectively inducing apoptosis in senescent cells for advanced anti-aging and senescence research. ✔ High Purity (≥99% HPLC) ✔ Third-Party Tested ✔ Fast USA Shipping. For lab use only.

⚠️ Note: Product image is illustrative only and may not represent the actual item. Refer to description for accurate details on purity, quantity & packaging.
73 People watching this product now!
SKU: N/A Category:
Description

FOXO4-DRI Peptide (Proxofim)

Welcome to buypeptidesonlineusa.com, your premier domestic source for high-purity research peptides. Our FOXO4-DRI (also known as Proxofim) is a cutting-edge synthetic senolytic peptide, meticulously manufactured for advanced investigations into cellular senescence, aging biology, tissue regeneration, and age-related disease models. As a targeted antagonist of the FOXO4-p53 interaction, it represents a revolutionary tool for researchers exploring the fundamental mechanisms of aging and strategies for senescent cell clearance. We ensure your critical research is supported by uncompromising quality, transparency, and rapid fulfillment.

🚚 FREE SHIPPING ON ORDERS OVER $300 | 🔐 SECURE CHECKOUT & DISCREET PACKAGING

⚠️ Important Research Compliance Notice

This product is intended strictly for laboratory research use only and is not for human consumption or veterinary use. This product is not a medicine, drug, or medical device. It has not been evaluated by the FDA. This peptide is sold for investigational purposes by qualified researchers and professionals only.

🔬 What is FOXO4-DRI Peptide?

FOXO4-DRI, also known as Proxofim, is a synthetic D-retro-inverso peptide composed of 46 amino acids . It is rationally designed to mimic a key domain of the Forkhead box protein O4 (FOXO4), a transcription factor involved in cellular stress resistance, metabolism, and apoptosis . The "DRI" in its name stands for D-Retro-Inverso, a critical modification where the amino acid sequence is reversed and all L-amino acids are substituted with their synthetic mirror-image D-amino acids . This unique configuration dramatically enhances the peptide's stability and resistance to enzymatic degradation, prolonging its bioavailability in research models .

The groundbreaking function of FOXO4-DRI lies in its senolytic activity—its ability to selectively target and eliminate senescent cells . Senescent cells are aged or damaged cells that have stopped dividing but do not die. They accumulate with age and secrete a cocktail of pro-inflammatory factors known as the Senescence-Associated Secretory Phenotype (SASP) , which contributes to tissue dysfunction and age-related pathologies .

FOXO4-DRI works by disrupting the interaction between FOXO4 and the tumor suppressor protein p53 within the nucleus of senescent cells . In these cells, the FOXO4-p53 complex prevents p53 from initiating apoptosis (programmed cell death). By competitively binding to p53, FOXO4-DRI displaces FOXO4, allowing phosphorylated p53 to translocate to the cytoplasm and trigger the apoptotic cascade, thereby selectively clearing senescent cells while sparing healthy, non-senescent cells . This mechanism was first described in a landmark 2017 study published in Cell, demonstrating its potential to restore tissue homeostasis in models of chemotoxicity and aging .

✅ Why Choose Buy Peptides Online USA for Your Research?

When you need to buy FOXO4-DRI peptide online, quality and consistency are non-negotiable. Here is why discerning researchers choose us:

  • Verified Purity: We provide access to independent third-party Certificate of Analysis (COA) documents, confirming purity via High-Performance Liquid Chromatography (HPLC) exceeding 99% and identity via Mass Spectrometry (MS) .
  • Optimal Storage & Handling: Our FOXO4-DRI is shipped in lyophilized form. For long-term stability, store desiccated at -20°C or below, protected from light and moisture . Avoid repeated freeze-thaw cycles.
  • Domestic Shipping: As a USA-based supplier, we offer fast, reliable shipping. Orders typically arrive within 2-5 business days in discreet, temperature-controlled packaging.
  • Research-Focused: We make no medical claims. Our service is built on integrity, providing accurately labeled products for legitimate scientific inquiry.
  • Secure Transactions: Enjoy peace of mind with secure checkout and multiple payment options, including credit cards and cryptocurrency.

🔎 Product Specifications & Technical Data

To ensure your research parameters are met with precision, here are the verified technical specifications for our FOXO4-DRI peptide. Purity is a critical determinant of research accuracy, and our product meets the high standards expected by the scientific community .

Specification Details
Common Names FOXO4-DRI, Proxofim, FOXO4 D-Retro-Inverso peptide, Forkhead box protein O4 inhibitor, Senolytic peptide
Sequence (Short) D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Sequence (Full, All D-Amino Acids) H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
Amino Acid Count 46
Molecular Formula C₂₂₈H₃₈₈N₈₆O₆₄
Molecular Weight ~5358.05 g/mol
CAS Number 2460055-10-9
Purity ≥99% (Verified via HPLC)
Physical Appearance White lyophilized (freeze-dried) powder
Solubility Soluble in water and DMSO . Typically reconstituted in sterile PBS or water for research applications.
Storage Conditions (Lyophilized) Store desiccated at -20°C or below. Protect from light and moisture. Stable for up to 3 years under these conditions .
Storage (Reconstituted) Aliquot and store at -80°C for up to 1 year. Avoid repeated freeze-thaw cycles .
Quality Verification HPLC, Mass Spectrometry (MS)

🧪 Key Research Applications & Focus Areas

FOXO4-DRI's selective senolytic mechanism makes it a powerful and precise tool across a wide spectrum of advanced biomedical research.

  • 🕰️ Cellular Senescence & Aging Biology: The foundational application of FOXO4-DRI is in studying the role of senescent cell accumulation in aging. Researchers use it to model senescence clearance in vitro and in vivo, investigating how eliminating these cells can ameliorate age-related phenotypes and restore tissue function . It is a key tool for exploring the "hallmarks of aging" and developing senolytic interventions.

  • ❤️ Cardiovascular & Vascular Research: Recent studies have demonstrated FOXO4-DRI's therapeutic potential in vascular aging. Research published in Frontiers in Bioengineering and Biotechnology (2026) shows that FOXO4-DRI treatment effectively suppresses aortic aging and improves vascular function in aged mice by targeting senescent endothelial cells . It promotes the apoptosis of these cells via the p53/BCL-2/Caspase-3 pathway, thereby improving endothelial-dependent vasodilation and reducing vascular inflammation .

  • 🫁 Pulmonary Research: FOXO4-DRI is used to investigate the complex role of senescent cells in lung diseases. Studies have explored its effects in models of pulmonary arterial hypertension, where the clearance of senescent pulmonary endothelial cells has been shown to influence hemodynamics and vascular remodeling .

  • 🧬 Fibrosis & Wound Healing: Research published in Communications Biology (Nature, 2025) highlights FOXO4-DRI's potential in treating fibrotic conditions like keloids . By inducing apoptosis in senescent fibroblasts within the keloid microenvironment, FOXO4-DRI reduces the pro-inflammatory SASP and shows promise as a strategy to prevent the aggressive growth and recurrence of pathological scars .

  • 🧪 Reproductive Endocrinology: Studies have investigated FOXO4-DRI for its ability to alleviate age-related testosterone deficiency. In aged mice, it has been shown to target and eliminate senescent Leydig cells in the testes, thereby restoring testosterone secretion and improving spermatogenesis .

  • 🧬 Cancer Research & Chemotoxicity: The foundational 2017 Cell paper demonstrated FOXO4-DRI's ability to clear senescent cells induced by chemotherapy, restoring tissue homeostasis and reducing the side effects of chemotoxicity without affecting healthy cells . It is also used to study the role of therapy-induced senescence in cancer recurrence.

🔬 How Does FOXO4-DRI Work? (Mechanism of Action)

The mechanism of FOXO4-DRI involves a precise molecular disruption that triggers apoptosis selectively in senescent cells :

  • Targeted Disruption: FOXO4-DRI is designed to mimic the p53-binding domain of FOXO4. It enters the cell and competitively binds to the transactivation domain 2 (TAD2) of p53, disrupting the native FOXO4-p53 interaction that keeps senescent cells alive .
  • Nuclear Exclusion of p53: By displacing FOXO4, FOXO4-DRI allows phosphorylated p53 (p53-pS15) to be released and exit the nucleus .
  • Activation of Apoptosis: Once in the cytoplasm, p53 triggers a transcription-independent pro-apoptotic pathway. It activates pro-apoptotic proteins like BAX, which then initiate the mitochondrial apoptotic cascade involving cleaved caspase-3, leading to the selective elimination of the senescent cell .
  • Enhanced Stability via D-Amino Acids: The use of D-retro-inverso configuration makes the peptide highly resistant to proteolytic degradation, significantly extending its half-life in biological systems compared to standard L-amino acid peptides .

📝 Handling, Storage, and Preparation for Research

Proper handling is critical to maintaining peptide integrity and ensuring experimental validity .

  • Receiving & Storage: Upon receipt, store the lyophilized vial in a freezer at -20°C (-4°F) or below. Protect from light and moisture. Lyophilized FOXO4-DRI is stable for up to 3 years under these conditions .
  • Reconstitution: To prepare stock solutions, FOXO4-DRI is soluble in sterile water or DMSO . Allow the peptide to warm to room temperature in a desiccator before opening. Gently swirl to dissolve; avoid vigorous vortexing to prevent denaturation.
  • Dosage Considerations:
    • In vivo (Rodent): Preclinical studies have used intraperitoneal injections of FOXO4-DRI at doses of 5 mg/kg administered every other day for one month to achieve senescent cell clearance and improve tissue function .
    • In vitro: Cell culture studies have used concentrations in the low micromolar range (e.g., 25 μM) to induce apoptosis in senescent fibroblasts .
  • Safety & Handling: Always use personal protective equipment (PPE) such as gloves and safety goggles when handling. Work in a laminar flow hood or well-ventilated area. Dispose of all waste in appropriate biohazard containers.

❓ Frequently Asked Questions (FAQ)

Q1: What does FOXO4-DRI stand for and what makes it unique?

A: FOXO4-DRI stands for Forkhead box protein O4 – D-Retro-Inverso. Its uniqueness lies in its D-retro-inverso structure, where the peptide is synthesized with D-amino acids in a reversed sequence. This makes it highly stable and resistant to breakdown, allowing it to effectively compete with the natural FOXO4 protein inside cells .

Q2: What is a "senolytic" and how is FOXO4-DRI one?

A: A senolytic is an agent that selectively induces apoptosis (programmed cell death) in senescent cells—aged, dysfunctional cells that accumulate with age and drive inflammation. FOXO4-DRI is a senolytic because it disrupts the FOXO4-p53 interaction that keeps these cells alive, causing them to self-destruct .

Q3: How do I verify the quality of your FOXO4-DRI?

A: We are committed to transparency. Our product listings provide access to a third-party Certificate of Analysis (COA) . This document validates the compound's identity via Mass Spectrometry (MS) and its purity via High-Performance Liquid Chromatography (HPLC), which is ≥99% .

Q4: In what research areas is FOXO4-DRI commonly used?

A: It is primarily used in aging biology, cardiovascular aging, fibrosis research, reproductive endocrinology, and studies on chemotoxicity and cancer .

Q5: Is FOXO4-DRI safe for research use?

A: As with all research peptides, it is intended for laboratory use only. In preclinical studies, it has demonstrated selective targeting of senescent cells with minimal effects on healthy cells . However, all standard laboratory safety protocols must be followed.

📦 Our Services & Guarantees

  • 24/7 Customer Support: Our team is available to answer your pre- and post-sales questions.
  • Authenticity Guarantee: We guarantee that you receive the exact product described, with full documentation and lot matching.
  • Product Replacement: In the unlikely event of damage during shipping, we have a clear process for claims and replacement.
  • Technical Consultation: Contact us for assistance with solubility or handling protocols.

🚀 How to Buy FOXO4-DRI Peptide Online

Purchasing from buypeptidesonlineusa.com is simple and secure.

  1. Browse & Select: Choose the quantity you need (e.g., 1mg, 5mg, 10mg vial).
  2. Add to Cart: Proceed to our secure checkout.
  3. Payment: We accept major credit cards and cryptocurrency (Bitcoin, Ethereum, USDT) for privacy and convenience.
  4. Shipping: Orders are processed within 24 hours on business days and shipped in discreet, temperature-controlled packaging. Domestic orders typically arrive in 2-5 days.

Ready to advance your senescence and aging research? Add high-purity FOXO4-DRI (Proxofim) to your cart today.

Additional information
Analysis Certificate

COA Available

Certifications

Third-Party Tested

,

GMP Manufactured

Intended Use

Research Use Only (RUO)

,

For Laboratory Use

,

Not for Human Consumption

,

Not for Diagnostic Use

Purity

≥98%

Shelf Life

12 months

Storage

Store in a Cool, Dry Place

,

Protect from Light

,

Refrigerate (2-8°C)

Form

Vials (Injectable, Often Lyophilized Powder or Solution)

Primary Function

Cellular Senescence & Aging Research

Functional Sub-Type

Senolytic Peptide

Quantity

10mg