Sermorelin Nasal Spray

$60.00

🧬 Sermorelin (GRF 1-29) Nasal Spray for Advanced GH Research: A ready-to-use formulation of the synthetic GHRH analog. The physiological secretagogue for studying pulsatile GH release, IGF-1 modulation, and metabolic pathways without pituitary desensitization. Precisely metered spray. Lab-verified purity. Strictly for research use.

⚠️ Note: Product image is illustrative only and may not represent the actual item. Refer to description for accurate details on purity, quantity & packaging.
61 People watching this product now!
SKU: N/A Category:
Description

🔬 Product Overview: The Physiological GHRH Analog for Endocrine Research

Welcome to the forefront of neuroendocrine and growth hormone research. At Buy Peptides Online USA, we are pleased to present our Sermorelin Nasal Spray—a specialized, ready-to-use formulation of the synthetic 29-amino acid peptide corresponding to the bioactive fragment of human Growth Hormone-Releasing Hormone (GHRH), designed for laboratory investigation into the physiological regulation of the GH/IGF-1 axis.

Sermorelin, also known as GRF(1-29) or GHRH(1-29), represents the minimal sequence of native GHRH that retains full biological activity . Unlike other growth hormone secretagogues that act through the ghrelin receptor (GHS-R), Sermorelin is a true GHRH analog, selectively activating the GHRH receptor on pituitary somatotrophs. This targeted mechanism promotes the synthesis and pulsatile release of growth hormone in a manner that closely mimics the body's natural physiological rhythm, without the risk of pituitary desensitization associated with continuous GHRH stimulation . Its development and characterization have been pivotal in understanding the hypothalamic control of growth hormone secretion.

Our nasal spray format offers researchers a practical, non-invasive delivery method for animal model studies, eliminating the variables associated with reconstitution and providing a consistent, metered dose for reproducible research protocols. Intranasal administration provides a direct pathway to the systemic circulation and, importantly, to the hypothalamus via the olfactory and trigeminal pathways, making it a relevant route for studying this centrally-acting neuropeptide.

🔍 What is Sermorelin (GRF 1-29)?

Peptide Structure and Nomenclature:
Sermorelin is a synthetic 29-amino acid peptide identical to the N-terminal fragment of human growth hormone-releasing hormone. It has the following precise characteristics :

Specification Details
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Sequence (Full Name) L-tyrosyl-L-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-asparaginyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucylglycyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-isoleucyl-L-methionyl-L-seryl-L-argininamide
Sequence Shortening YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular Formula C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight ~3357.9 g/mol
Monoisotopic Mass 3355.81 Da
CAS Number 86168-78-7
Synonyms GRF(1-29), GHRH(1-29), Sermorelin acetate, Growth Hormone Releasing Factor (1-29), Somatorelin, Geref

The Minimal Bioactive Sequence:
Sermorelin is the result of structure-activity studies that identified the N-terminal 29 amino acids of the 44-amino acid native GHRH as the minimum sequence required for full biological activity . Key features include:

  • Conserved N-Terminus: The first 29 residues contain all the structural elements necessary for high-affinity binding to the GHRH receptor and effective stimulation of GH release.
  • C-Terminal Amidation: The C-terminal arginine is amidated, which is critical for receptor recognition and biological potency .
  • Methionine Residue: The presence of methionine at position 27 makes the peptide susceptible to oxidation, a consideration for handling and storage.

Mechanism of Action:
Sermorelin acts as a selective, potent agonist of the GHRH receptor (GHRH-R) on pituitary somatotroph cells:

  • Gs Pathway Activation: Binding to GHRH-R activates the stimulatory G protein (Gs), increasing adenylyl cyclase activity and intracellular cAMP levels .
  • PKA Activation: Elevated cAMP activates protein kinase A (PKA), which phosphorylates transcription factors (e.g., CREB) involved in GH gene transcription and secretion .
  • GH Synthesis and Release: This signaling cascade stimulates both the synthesis of new GH and the release of stored GH from secretory granules .
  • Pulsatile Secretion: Importantly, Sermorelin preserves the physiological pulsatile pattern of GH release, as it acts on somatotrophs that are under the inhibitory influence of somatostatin, which waxes and wanes in a cyclical manner . Continuous exposure to Sermorelin does not lead to significant desensitization, unlike other GHRH isoforms .

⚙️ Key Features & Technical Specifications

When you choose to buy research peptides online from Buy Peptides Online USA, you are selecting products manufactured to the highest standards for laboratory use.

  • Primary Research Focuses: Hypothalamic-pituitary axis dynamics, GH/IGF-1 regulation, neuroendocrinology, pulsatile hormone secretion, somatotroph cell function, metabolic research (lipolysis, protein synthesis), aging research (somatopause), and sleep studies (GH-sleep interactions).

  • Delivery Format: Pre-formulated nasal spray with a metered pump, ensuring consistent, reproducible dosing in animal model research. Intranasal delivery is a validated route for peptide delivery to the central nervous system and systemic circulation.

  • Purity: ≥98% (Verified by third-party HPLC and MS).

  • Quality Verification: Every batch is accompanied by a Certificate of Analysis (COA) , utilizing High-Performance Liquid Chromatography (HPLC) to verify purity and Mass Spectrometry (MS) to confirm the peptide's molecular weight (~3357.9 Da) and sequence identity .

📊 Sermorelin Specifications Table

Specification Details
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Sequence Shortening YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular Formula C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight ~3357.9 g/mol
Monoisotopic Mass 3355.81 Da
CAS Number 86168-78-7
Synonyms GRF(1-29), GHRH(1-29), Sermorelin acetate, Geref
Purity ≥98% (HPLC/MS Verified)
Physical Appearance Clear, sterile solution in nasal spray device
Solubility Supplied as a ready-to-use solution
Storage Conditions Refrigerate at 2-8°C. Protect from light. Do not freeze.
Shelf Life 12-18 months (unopened); 30 days after first use
Intended Application Laboratory research use only. Not for human or veterinary use.

🧪 Primary Research Applications

This nasal spray formulation serves as a versatile tool for multiple lines of scientific inquiry. Below are key research areas where Sermorelin is commonly investigated:

🧬 GH/IGF-1 Axis Dynamics:
Sermorelin is the prototypical tool for studying the physiological regulation of the GH axis:

  • Pulsatile Release Studies: Because it acts through the native GHRH receptor and preserves the natural pulsatility of GH secretion, Sermorelin is invaluable for investigating the ultradian rhythms of GH release and their regulation by somatostatin .
  • Somatotroph Cell Function: It is used to study the intracellular signaling pathways (cAMP/PKA/CREB) in pituitary somatotrophs that control GH synthesis and secretion .
  • Receptor Pharmacology: Sermorelin serves as a reference agonist for studying GHRH receptor binding, trafficking, and desensitization.

⚖️ Metabolic Research:
GH is a key regulator of metabolism, and Sermorelin allows for the study of its downstream effects:

  • Lipolysis: Researchers use Sermorelin to investigate GH-mediated fat mobilization in adipose tissue, with the advantage of a physiological stimulation pattern .
  • Protein Synthesis: It is used in models studying GH's anabolic effects on muscle and other tissues .
  • Glucose Homeostasis: Sermorelin helps explore the complex interactions between GH and insulin sensitivity.

🧠 Neuroendocrine and Aging Research:
GH secretion declines with age (somatopause), and Sermorelin is a key tool in this field:

  • Somatopause Models: Sermorelin is used to study the age-related decline in GHRH responsiveness and to explore interventions that might restore GH pulsatility .
  • Sleep Studies: GH release is tightly coupled to slow-wave sleep. Sermorelin is used to investigate this neuroendocrine-sleep interaction .
  • Neuroprotection: GHRH and its analogs have been shown to have neuroprotective effects in some models, an emerging area of research .

⚕️ Comparative Endocrine Research:

  • GHRH vs. GHS-R Pathways: By comparing the effects of Sermorelin (a GHRH agonist) with GHRPs (GHS-R agonists like GHRP-2, GHRP-6, Ipamorelin), researchers can dissect the distinct and overlapping roles of these two key inputs to the GH axis .
  • Synergy Studies: Sermorelin is commonly used in combination with GHRPs to study the synergistic amplification of GH release, a fundamental property of the neuroendocrine system .

📝 Handling & Laboratory Use

Important Distinction:
This product is a Sermorelin Nasal Spray specifically formulated for research applications requiring non-invasive delivery. The peptide is pre-dissolved in a sterile, biocompatible solution appropriate for intranasal administration in laboratory animal models. It is ready to use and requires no reconstitution.

Storage Guidelines:

  • Critical Note: Sermorelin contains a methionine residue at position 27, which is susceptible to oxidation. Protect from light and minimize exposure to air.
  • Unopened: Store refrigerated at 2-8°C (36-46°F) . Do not freeze.
  • In Use: After first use, maintain refrigeration and use within 30 days for optimal stability.
  • Protection: Keep away from direct light and heat sources. For long-term storage of lyophilized material, -20°C under inert atmosphere is recommended .

Research Administration Considerations:

  • Intranasal Delivery: Intranasal administration is a validated route for peptide delivery to the CNS and systemic circulation. Each actuation delivers a precise, metered dose. Researchers must calculate appropriate dosing based on their specific animal model and study protocol.
  • Dosing Protocols: In published research, GHRH analogs are typically administered in doses ranging from 0.5-5.0 µg/kg in humans . For animal models, researchers should perform dose-response studies to determine optimal dosing for their specific endpoint.

Safety & Handling Precautions:

  • For laboratory research use only. Not for human or veterinary use .
  • Handle using appropriate personal protective equipment (PPE): gloves, lab coat, and eye protection.
  • Use in a well-ventilated area.
  • Dispose of unused material according to institutional biosafety guidelines.

✅ Why Choose Buy Peptides Online USA?

When you need to buy Sermorelin nasal spray online in the USA for research purposes, trust and verification are paramount. Here is why researchers consistently choose us:

🔬 Verified Quality Assurance:
We do not rely on claims. Each product batch is analyzed using Third-Party HPLC and Mass Spectrometry. You can view the Certificate of Analysis (COA) to verify the peptide's Molecular Weight (~3357.9 Da), sequence, and purity (>98%) . Given the susceptibility of the methionine residue to oxidation, our HPLC analysis specifically monitors for oxidized species to ensure product integrity.

🧪 Authenticity Guarantee:
Our peptides are sourced from GMP-compliant manufacturing facilities. We guarantee that the Molecular Formula (C₁₄₉H₂₄₆N₄₄O₄₂S) and Sequence (Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2) match the product specifications, ensuring your research is built on a foundation of quality.

📦 Fast & Discreet Shipping:
We understand that timely delivery is critical for ongoing research. We offer:

  • Fast, reliable shipping across the USA
  • Discreet, temperature-controlled packaging to maintain cold chain integrity
  • Tracking information for all orders
  • Free shipping on orders over $300

💼 Professional Research Support:
Our team understands the needs of the research community:

  • Technical Consultation: Questions about handling, storage, or research applications? Our knowledgeable team is here to help.
  • 24/7 Customer Support: We are available when you need us.
  • Product Replacement: Clear policies for damaged or incorrect items.
  • Research-Only Integrity: We provide clear, accurate information without medical claims or marketing exaggeration.

💳 Secure & Flexible Payment:

  • Secure checkout with data protection
  • Crypto Payments Accepted: Bitcoin, Ethereum, and USDT
  • Multiple payment options for your convenience

❓ Frequently Asked Questions (FAQ)

Q: What is the primary function of Sermorelin in research?

A: Sermorelin is primarily investigated as a physiological GHRH analog for studying the hypothalamic-pituitary regulation of GH secretion. Its main research applications include investigating pulsatile GH release, somatotroph cell function, metabolic effects of GH, and the neuroendocrine changes associated with aging .

Q: How does Sermorelin differ from GHRPs like GHRP-2 or Ipamorelin?

A: This is a fundamental distinction. Sermorelin acts on the GHRH receptor on pituitary somatotrophs, mimicking the body's natural GHRH. GHRPs act on the ghrelin receptor (GHS-R) in the pituitary and hypothalamus. Sermorelin preserves physiological pulsatility, while GHRPs primarily work by antagonizing somatostatin. They are often used together in research to study the synergistic control of GH secretion .

Q: What is the significance of Sermorelin being the "minimal bioactive sequence"?

A: Structure-activity studies revealed that the first 29 amino acids of the 44-amino acid native GHRH contain all the information necessary for full receptor binding and biological activity . This makes Sermorelin a more focused and stable research tool than the full-length hormone.

Q: Is this Sermorelin product ready to use?

A: Yes. Unlike lyophilized powders that require reconstitution with bacteriostatic water or acetic acid, our Sermorelin Nasal Spray arrives pre-formulated and ready for research use. This eliminates variables associated with reconstitution and ensures consistent dosing.

Q: How is the purity of Sermorelin verified, especially considering oxidation risk?

A: Every batch undergoes rigorous third-party testing using High-Performance Liquid Chromatography (HPLC) to verify purity (≥98%) and to specifically monitor for oxidized species (e.g., methionine sulfoxide). Mass Spectrometry (MS) confirms the peptide's identity and Molecular Weight (~3357.9 Da) . These Certificates of Analysis are available upon request.

Q: Why is the methionine residue in Sermorelin important for storage?

A: Methionine is susceptible to oxidation, which can alter the peptide's structure and reduce its biological activity. This is why it is critical to store Sermorelin properly (refrigerated, protected from light) and to use it within the recommended timeframe after opening .

Q: How should the Sermorelin Nasal Spray be stored?

A: Store refrigerated at 2-8°C (36-46°F) at all times. Do not freeze. Protect from light. After first use, maintain refrigeration and use within 30 days for optimal stability to minimize oxidation.

Q: Is this product for human use?

A: No. This product is sold strictly for research and laboratory use only . It is not a drug, food, or cosmetic, and is not for human or veterinary use. We maintain strict research-only integrity in all our products.

📦 Packaging & Shipping

  • Packaging: Professional, discreet, temperature-controlled packaging to maintain cold chain integrity
  • Domestic Shipping: Fast USA shipping (2-5 business days)
  • International Shipping: Available worldwide (subject to local regulations)
  • Free Shipping: On all USA orders over $300
  • Tracking: Provided for all orders

⚠️ Important Notes & Warnings

  • For Research Use Only: This product is intended for laboratory research purposes only . It is not for human consumption, not for medical use, and not for veterinary use.
  • Regulatory Compliance: Buyers are responsible for compliance with all applicable local, state, and federal laws regarding the purchase and use of research peptides.
  • Oxidation Risk: Due to the presence of methionine, the peptide is susceptible to oxidation. Handle and store as recommended.
  • Safety Data: Handle with appropriate laboratory safety protocols. Use personal protective equipment.
  • No Medical Claims: We make no claims regarding diagnostic, therapeutic, or medical benefits. All information provided is for scientific reference only.

Ready to advance your neuroendocrine research with the physiological precision of Sermorelin? Secure your supply of this premium Sermorelin Nasal Spray today. With verified purity, professional support, and fast, temperature-controlled shipping from the USA, Buy Peptides Online USA is your trusted partner for quality research peptides.

🔐 Secure Checkout | Crypto Payments Accepted | Free Shipping on Orders $300+

Additional information
Analysis Certificate

COA Available

Certifications

Third-Party Tested

,

GMP Manufactured

Intended Use

Research Use Only (RUO)

,

For Laboratory Use

,

Not for Human Consumption

,

Not for Diagnostic Use

Purity

≥98%

Shelf Life

90 days

Storage

Store in a Cool, Dry Place

,

Protect from Light

,

Refrigerate (2-8°C)

Form

Nasal Spray

Primary Function

Growth Hormone Support

Functional Sub-Type

GHRH

,

Growth Hormone Releasing Hormone (GHRH)

Quantity

10mg