Placeholder
GHRP-2, CJC-1295 no DAC (Blend) Price range: $85.00 through $590.00
Back to products
Placeholder
GHK Basic (Tripeptide-1) Price range: $35.00 through $136.00

GHRH Peptide (GH-Releasing Hormone)

$55.00

The hypothalamic master regulator. Our GHRH Peptide (1-29) is the bioactive amidated fragment of native human Growth Hormone-Releasing Hormone. Validated GHRH-R agonist for cAMP/PKA/CREB signaling assays. Third-party tested via RP-HPLC & MS. Batch COA available. USA fast shipping. 🧪🧠📈

⚠️ Note: Product image is illustrative only and may not represent the actual item. Refer to description for accurate details on purity, quantity & packaging.
108 People watching this product now!
SKU: N/A Category:
Description

🔬 Introduction: The Hypothalamic Somatostatin Antagonist

Welcome to Buy Peptides Online USA, the trusted source for high-purity research peptides online. Our GHRH Peptide is the authentic, full-length bioactive fragment (amino acids 1-29) of the native human Growth Hormone-Releasing Hormone, also known as Sermorelin or GRF(1-29)-NH₂ .

This is not a modified analog (CJC-1295, Mod GRF, Tesamorelin). This is the original sequence—the precise molecular tool used for decades to elucidate GHRH receptor pharmacology, pituitary somatotroph function, and the neuroendocrine regulation of anabolism .

Why choose native GHRH (1-29)?

  • Physiological Fidelity: Models the endogenous ligand with 100% sequence homology to the N-terminal bioactive core of hypothalamic GHRH(1-44) .
  • Short-Acting Pulse: Half-life <10 minutes. Ideal for ultradian rhythm and receptor recovery studies .
  • Competitive Binding: The standard for GHRH-R radioligand displacement assays and cAMP functional antagonism experiments.

This product is strictly for in vitro and laboratory research use only.

Why Choose This Native GHRH Peptide from Buy Peptides Online USA?

The peptide research market is saturated with “research liquids” of undefined provenance. We differentiate through sequence fidelity and analytical transparency.

Feature Buy Peptides Online USA Standard Industry Commodity Standard
🔬 Identity Native Human GHRH(1-29)-NH₂ Unspecified “GHRH Analog”
🧪 Purity Threshold ≥98.0% (RP-HPLC, verified) “≥95%” or Unspecified
⚗️ Analytical Verification RP-HPLC + ESI-MS (batch chromatograms) Spot-checked or Omitted
📄 Documentation Batch-Specific COA (Immediate Request) “COA Available” (Delayed)
🔬 Counter-Ion Acetate (Biocompatible, TFA-free available upon request) Trifluoroacetate (TFA – may interfere in sensitive assays)
❄️ Formulation Lyophilized from phosphate buffer Unspecified buffers
🇺🇸 Logistics USA Domestic Shipping (2-5 Day Transit) International (Customs Risk)
🔒 Compliance Strict RUO Labeling & Legal Review Ambiguous Labeling

Why does this matter? In receptor pharmacology, using the wrong analog (e.g., CJC-1295 for a GHRH-R binding study) invalidates your data. Our peptide is sequence-verified to match the endogenous ligand’s bioactive core.

🧪 What Is GHRH Peptide (Sermorelin)? (Mechanistic Deep-Dive)

🔬 Definition & Nomenclature

GHRH (Growth Hormone-Releasing Hormone) is a 44-amino acid neuropeptide synthesized in the arcuate nucleus of the hypothalamus . It is the principal positive regulator of pituitary GH synthesis and secretion.

Our product is Sermorelin (INN) , the synthetic acetate salt of the fully bioactive 1-29 fragment of human GHRH. This fragment retains 100% of the biological activity of the full-length 44-amino acid hormone .

🧬 Peptide Structure & Sequence

Specification Details
Full Sequence (Single Letter) YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Full Sequence (Triple Letter) Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
Molecular Formula C₁₄₉H₂₄₆N₄₄O₄₂S (Free Base)
Molecular Weight (Free Base) 3358.9 g/mol
Molecular Weight (Acetate Salt) ~3640 g/mol (Varies by counter-ion ratio)
CAS Number 86168-78-7 (Sermorelin Acetate)
PubChem CID 16132336 (Sermorelin)
Isoelectric Point (pI) ~11.0 (Basic peptide)
UniProt Accession # P01286 (Somatoliberin Precursor)
Synonyms Somatoliberin, GRF(1-29)-NH₂, Growth Hormone Releasing Factor, Somatocrinin, GHRF, Sermorelin

⚙️ How Does GHRH Work? Signal Transduction Cascade

GHRH is the endogenous ligand for the GHRH receptor (GHRH-R) , a Class B1 G-protein-coupled receptor (GPCR) with seven transmembrane domains .

Step-by-Step Signaling Pathway :

  1. Ligand Binding: GHRH(1-29) binds to the extracellular N-terminal domain of GHRH-R on pituitary somatotrophs.
  2. Gαs Activation: Conformational change activates the stimulatory G-protein (Gαs).
  3. Adenylyl Cyclase: Gαs activates adenylyl cyclase, converting ATP → cAMP.
  4. PKA Activation: cAMP binds to Protein Kinase A regulatory subunits, releasing catalytic subunits.
  5. CREB Phosphorylation: Catalytic PKA subunits translocate to the nucleus and phosphorylate CREB (cAMP Response Element-Binding protein) at Ser133.
  6. Gene Transcription: pCREB recruits CBP/p300 and binds to cAMP response elements (CRE) in the GH1 promoter.
  7. Pit-1 Activation: GHRH signaling upregulates Pit-1 (POU1F1) , the pituitary-specific transcription factor essential for GH gene expression and somatotroph differentiation .
  8. Exocytosis: Pre-synthesized Growth Hormone vesicles are released into systemic circulation.

Negative Regulation: Somatostatin (SS) from the periventricular nucleus inhibits this pathway via Gαi, suppressing adenylyl cyclase .

📊 Peptide Specifications & Technical Data

Verified via Third-Party RP-HPLC and ESI-MS. COA available upon request.

Specification Product Standard Test Method
Quantity 1mg per vial (Bulk sizes available upon request) Gravimetric
Purity ≥98.0% RP-HPLC (Area Normalization)
Appearance Sterile Filtered White Lyophilized Powder Visual Inspection
Molecular Weight 3358.9 Da (Theoretical, Free Base) ESI-MS (Confirmed)
Counter-Ion Acetate (<15%) HPLC
Endotoxin (LAL) <1.0 EU/μg Kinetic Turbidimetric
Solubility Soluble in sterile water / Bacteriostatic Water (≥1 mg/mL). Soluble in 1% Acetic Acid. Visual Inspection
Formulation Lyophilized from 1.7 mg/mL sodium phosphate buffer (0.1 mg NaH₂PO₄, 1.6 mg Na₂HPO₄)
Storage (Lyophilized) -20°C (-4°F) . Store desiccated. Protect from light. Stability Protocol
Storage (Reconstituted) 2-8°C (35-46°F) . Use within 2-7 days. Do NOT freeze. Stability Protocol
Shelf Life 12 months (lyophilized, -20°C) Accelerated Degradation Study

🔬 Primary Research Applications & Investigational Focus

This product is for laboratory research only. The following outlines mechanisms reported in peer-reviewed, non-human studies .

🧠 1. GHRH Receptor Binding & cAMP Functional Assays

Native GHRH(1-29) is the gold standard agonist for:

  • Radioligand Binding: Displacing ¹²⁵I-GHRH from GHRH-R in membrane preparations.
  • cRP-HLPA Accumulation: Quantifying second messenger signaling via ELISA or HTRF.
  • β-Arrestin Recruitment: Assessing GPCR desensitization and internalization kinetics .

📈 2. Somatotroph Cell Culture & Pulsatility Modeling

Researchers utilize primary rat pituitary cultures or immortalized somatotroph cell lines (e.g., GH3, GH4C1) to study:

  • Dose-dependent GH release (measured by rat/mouse GH ELISA).
  • Somatotroph differentiation and Pit-1 expression.
  • Desensitization kinetics following repeated GHRH pulses .

🧬 3. GH-IGF-1 Axis Feedback Loops

GHRH is essential for investigating negative feedback by IGF-1 on the hypothalamus and pituitary. Studies utilize GHRH stimulation before and after IGF-1 pre-treatment to model short-loop inhibition.

🛡️ 4. Extra-Pituitary GHRH-R Signaling

Recent research confirms GHRH-R expression in peripheral tissues, including:

  • Cardiomyocytes: Cardioprotective signaling via PI3K/AKT .
  • Fibroblasts: Wound healing and ECM remodeling .
  • Immune Cells: Modulation of cytokine release .
  • Neurons: Neuroprotection and sleep architecture regulation .

Native GHRH is the preferred tool for validating GHRH-R expression and functional coupling in these extra-pituitary models.

💤 5. Sleep & Circadian Rhythm Research

GHRH is a well-documented sleep-promoting peptide. It is directly implicated in the regulation of slow-wave sleep (SWS) and NREMS. Researchers utilize GHRH to dissect the hypothalamic circuitry linking metabolic state and sleep homeostasis .

🧪 Quality Verification: HPLC, Mass Spectrometry & COA

We do not rely on spot-checking. Every batch of our GHRH Peptide undergoes rigorous analytical chemistry validation per USP/EP guidelines.

  1. Reverse-Phase High Performance Liquid Chromatography (RP-HPLC):
    • Method: C18 Column, Gradient Elution (0.1% TFA/ACN).
    • Criteria: Purity ≥98.0% . Single principal peak with retention time matching certified Sermorelin reference standard .
    • Scrutiny: Absence of deletion sequences (e.g., des-Met²⁷, des-Asn⁸) and oxidation products (Met²⁷ sulfoxide).
  2. Mass Spectrometry (MS):
    • Method: Electrospray Ionization (ESI-MS).
    • Criteria: 3358.9 ± 2.0 Da. Confirms full-length, correctly amidated 29-amino acid chain.
  3. Endotoxin Analysis (LAL Test):
    • Method: Kinetic Chromogenic LAL.
    • Criteria: <1.0 EU/μg. Suitable for sensitive primary pituitary cell cultures.
  4. Certificate of Analysis (COA):
    A batch-specific COA is available immediately upon request. This document includes:

    • Lot Number & Manufacturing Date
    • Retention Time & Purity Percentage (HPLC Chromatogram)
    • MS Spectrum & Molecular Weight Confirmation
    • Appearance & Solubility Verification

❄️ Handling, Storage & Reconstitution Protocol

For Laboratory Use Only – Not for Human Consumption.

📦 Long-Term Storage (Lyophilized)

  • Temperature: Store at -20°C (-4°F) in a manual-defrost freezer .
  • Stability: Lyophilized powder is stable for 12 months at -20°C. Stable at room temperature for up to 3 weeks, but refrigeration is mandatory for archival storage .
  • Environment: Keep desiccated. Protect from UV light and humidity.

💧 Reconstitution Instructions (Standard Laboratory Protocol)

Based on standard research protocols for GHRH :

  1. Equilibrate: Allow the vial to reach room temperature in a desiccator to prevent moisture condensation.
  2. Inject: Using a sterile syringe, inject 1.0 mL of sterile 18 MΩ·cm H₂O or Bacteriostatic Water (BAC) slowly against the inner glass wall.
    • Resulting Concentration: 1.0 mg/mL .
  3. Swirl: Do NOT vortex or shake vigorously. Shaking introduces oxygen radicals and shears peptide bonds. Gently swirl until the liquid is clear.
  4. Alternative Solvent: For maximum solubility (>1 mg/mL) or if solubility issues arise, reconstitute in 1% acetic acid .

🧊 Post-Reconstitution Handling

  • Storage: 2-8°C (Refrigerator). Do not freeze .
  • Duration: Use within 2-7 days. GHRH is labile in solution.
  • ⚠️ Critical Alert: Freezing reconstituted peptides causes ice crystal shearing, permanently destroying tertiary structure. Do not refreeze.
  • Stabilization: For long-term storage of reconstituted peptide (>7 days), aliquot and add a carrier protein (0.1% HSA or BSA) before freezing at -80°C. Avoid freeze-thaw cycles .

📦 Packaging, Shipping & Buyer Services

We engineer the unboxing experience to match the precision of our analytics.

  • 📐 Discreet & Secure Packaging: Vials are seated in medical-grade foam inside rigid, opaque mailers.
  • 🌡️ Thermal Integrity: Seasonal cold-pack inserts included to maintain ≤4°C during summer transit.
  • 🇺🇸 USA Dispatch: Shipped from domestic logistics hubs. Transit time: 2-5 business days.
  • 🛡️ Buyer Guarantees:
    • Authenticity Guarantee: Direct sourcing from cGMP-compliant, FDA-registered facilities.
    • 24/7 Technical Consultation: Lab handling queries answered via email support.
    • Product Replacement: Immediate replacement for damaged or compromised vials (photographic proof required).
    • Complaint Handling: Dedicated resolution team for shipping discrepancies.

Frequently Asked Questions (FAQ)

Q: What is the difference between this “GHRH Peptide” and “CJC-1295” or “Modified GRF”?

A: This is the native, unmodified bioactive fragment. CJC-1295 (no DAC) is Modified GRF 1-29—it contains four amino acid substitutions (D-Ala², Gln⁸, Ala¹⁵, Leu²⁷) to resist DPP-4 degradation. Our GHRH is the original Sermorelin sequence (Asn⁸, Gly¹⁵, Met²⁷), with a half-life of <10 minutes. Choose this for physiological pulse modeling and receptor binding studies .

Q: What is the purity of this peptide?

A: ≥98.0% . This is verified via RP-HPLC (area normalization) and ESI-MS for each batch. Batch-specific COAs are available immediately upon request .

Q: Why is the GHRH sequence sometimes listed as 44 amino acids?

A: Endogenous human GHRH is 44 amino acids. However, the biological activity resides entirely in the N-terminal 1-29 fragment. The 1-29 amide (Sermorelin) is equipotent to the full 1-44 hormone and is the standard research tool .

Q: Is this peptide amidated (-NH₂)?

A: Yes. The C-terminus is amidated (Arg-NH₂). C-terminal amidation is critical for full biological potency and receptor binding affinity .

Q: What is the counter-ion? Why does it matter?

A: Our standard formulation is Acetate. Peptides are often supplied as Trifluoroacetate (TFA) salts from HPLC purification. TFA can interfere with cell-based assays and NMR studies . We offer TFA-free (Acetate exchange) processing upon request for sensitive applications.

Q: How long is the shelf life after reconstitution?

A: 2-7 days at 2-8°C. GHRH is less stable in solution than modified analogs. Do not use after 7 days. For longer storage, aliquot with carrier protein (0.1% BSA) and freeze at -80°C .

Q: Is this peptide suitable for in vivo animal research?

A: Our products are labeled “For Research Use Only. Not for Human Consumption.” Determining suitability for specific IACUC-approved animal protocols is the responsibility of the qualified researcher and their institutional review board.

Q: Do you provide dosing instructions?

A: Absolutely not. As a strict Research Use Only (RUO) supplier, we strictly prohibit providing protocols for human or animal administration. We supply the raw material; determining molar concentrations for specific in vitro assays (e.g., 1nM vs. 100nM) is the responsibility of the qualified researcher.

Research Use Only (RUO)
This product is sold exclusively for laboratory research and educational purposes. It is NOT a drug, food, dietary supplement, or cosmetic. This product has not been approved by the U.S. Food and Drug Administration (FDA) . GHRH and its synthetic analogs are included on the World Anti-Doping Agency (WADA) Prohibited List. Bodily introduction of any kind, including human or veterinary consumption, injection, or topical application, is strictly prohibited and illegal .

By purchasing from Buy Peptides Online USA, you certify that you are a qualified researcher, scientist, or laboratory professional and will handle this material in compliance with all applicable local, state, and federal regulations, including institutional biosafety protocols.

Transactional Close: Why Principal Investigators Buy Here

Ready to investigate the master regulator of anabolism with confidence? Here is why top neuroendocrinology labs buy peptides online from Buy Peptides Online USA:

  • 💰 Verified Value: 1mg/vial of sequence-verified, ≥98% pure native GHRH(1-29) at competitive pricing.
  • ⚡ Velocity: Same-day processing on orders placed before 2:00 PM EST.
  • 🔒 Secure Checkout: Accepting major credit cards and cryptocurrency (BTC/ETH/USDT) for institutional privacy and discretion.
  • 📞 Post-Sale Support: Direct access for technical consultation regarding solubility, handling, or analytical data interpretation.

📄 Request a COA: Use our contact form with your Order Number or Batch Lot Number to receive the full analytical package, including HPLC chromatograms and MS spectra.

Additional information
Analysis Certificate

COA Available

Certifications

Third-Party Tested

,

GMP Manufactured

Intended Use

Research Use Only (RUO)

,

For Laboratory Use

,

Not for Human Consumption

,

Not for Diagnostic Use

Purity

≥98%

Shelf Life

12 months

Storage

Store in a Cool, Dry Place

,

Protect from Light

,

Refrigerate (2-8°C)

Form

Vials (Injectable, Often Lyophilized Powder or Solution)

Primary Function

Growth Hormone Support

Functional Sub-Type

Growth Hormone Releasing Hormone (GHRH)

Quantity

5mg